TBC1D10C Antibody - N-terminal region : FITC

TBC1D10C Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55894_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TBC1D10C inhibits the Ras signaling pathway through its intrinsic Ras GTPase-activating protein (GAP) activity. TBC1D10C acts as a negative feedback inhibitor of the calcineurin signaling pathway that also mediates crosstalk between calcineurin and Ras.Carabin is an endogenous inhibitor of calcineurin (see MIM 114105) that also inhibits the Ras (see MIM 190020) signaling pathway through its intrinsic Ras GTPase-activating protein activity (Pan et al., 2007 [PubMed 17230191]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TBC1D10C

Key Reference: Pan,F., (2007) Nature 445 (7126), 433-436

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: MAQALGEDLVQPPELQDDSSSLGSDSELSGPGPYRQADRYGFIGGSSAEP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Carabin

Protein Size: 446

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55894_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55894_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 374403
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×