TBC1D14 Antibody - N-terminal region : FITC

TBC1D14 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP56315_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TBC1D14 may act as a GTPase-activating protein for Rab family protein(s).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TBC1D14

Key Reference: Tempel,W., (2008) Proteins 71 (1), 497-502

Molecular Weight: 76kDa

Peptide Sequence: Synthetic peptide located within the following region: MTDGKLSTSTNGVAFMGILDGRPGNPLQNLQHVNLKAPRLLSAPEYGPKL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TBC1 domain family member 14

Protein Size: 693

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56315_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56315_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57533
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×