TBC1D22A Antibody - middle region : HRP

TBC1D22A Antibody - middle region : HRP
Artikelnummer
AVIARP55030_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TBC1D22A contains 1 Rab-GAP TBC domain. It may act as a GTPase-activating protein for Rab family protein(s).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of TBC1D22A

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: MTWKLLSGYLPANVDRRPATLQRKQKEYFAFIEHYYDSRNDEVHQDTYRQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: TBC1 domain family member 22A

Protein Size: 517

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55030_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55030_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 25771
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×