TBC1D28 Antibody - middle region : Biotin

TBC1D28 Antibody - middle region : Biotin
Artikelnummer
AVIARP54497_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TBC1D28

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: QKMLADWTKYRSTKKLSQRVCKVIPLAVRGRALSLLLDIDKIKSQNPGKY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TBC1 domain family member 28

Protein Size: 210

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54497_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54497_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 254272
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×