TBK1 Antibody - middle region : HRP

TBK1 Antibody - middle region : HRP
Artikelnummer
AVIARP54922_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The NF-kappa-B (NFKB) complex of proteins is inhibited by I-kappa-B (IKB) proteins, which inactivate NFKB by trapping it in the cytoplasm. Phosphorylation of serine residues on the IKB proteins by IKB kinases marks them for destruction via the ubiquitinat

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TBK1

Key Reference: Morton,S., (2008) FEBS Lett. 582 (6), 997-1002

Molecular Weight: 84kDa

Peptide Sequence: Synthetic peptide located within the following region: QEGTHPKDRNVEKLQVLLNCMTEIYYQFKKDKAERRLAYNEEQIHKFDKQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serine/threonine-protein kinase TBK1

Protein Size: 729

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54922_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54922_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 29110
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×