TBL2 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TBL2 is a member of the beta-transducin protein family. Most proteins of the beta-transducin family are involved in regulatory functions. This protein is possibly involved in some intracellular signaling pathway. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23. This gene encodes a member of the beta-transducin protein family. Most proteins of the beta-transducin family are involved in regulatory functions. This protein is possibly involved in some intracellular signaling pathway. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TBL2

Key Reference: Kathiresan,S., (2008) Nat. Genet. 40 (2), 189-197

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: RSGRPACQKANGFPPDKSSGSKKQKQYQRIRKEKPQQHNFTHRLLAAALK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transducin beta-like protein 2

Protein Size: 447

Purification: Affinity Purified

• Artikelnummer: AVIARP53685_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53685_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rabbit, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 26608
• Wirt: Rabbit
• Konjugat: Conjugated, FITC