Tbx10 Antibody - middle region : HRP

Tbx10 Antibody - middle region : HRP
Artikelnummer
AVIARP58030_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Tbx10 is a probable transcriptional regulator involved in developmental processes.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: FVDPRKDSARYAQENFKSFVFTETQFTAVTAYQNHRITQLKIASNPFAKG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: T-box transcription factor TBX10

Protein Size: 385

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58030_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58030_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 109575
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×