TCP11 Antibody - middle region : Biotin

TCP11 Antibody - middle region : Biotin
Artikelnummer
AVIARP53730_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: TCP11 may play an important role in sperm function and fertility.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TCP11

Key Reference: Ma,Y.X., (2003) Zhongguo Yi Xue Ke Xue Yuan Xue Bao 25 (2), 122-128

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: CVCSVIDQRIHLFLKCCLVLGVQRSLLDLPGGLTLIEAELAELGQKFVNL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: T-complex protein 11 homolog

Protein Size: 441

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53730_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53730_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 6954
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×