TCP11 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: TCP11 may play an important role in sperm function and fertility.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TCP11

Key Reference: Ma,Y.X., (2003) Zhongguo Yi Xue Ke Xue Yuan Xue Bao 25 (2), 122-128

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: DMVNYTIQSLQPHLQEHSIQYERAKFQELLNKQPSLLNHTTKWLTQAAGD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: T-complex protein 11 homolog

Protein Size: 441

Purification: Affinity Purified

• Artikelnummer: AVIARP53731_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53731_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 6954
• Wirt: Rabbit
• Konjugat: Conjugated, HRP