TCP11L2 Antibody - C-terminal region : FITC

TCP11L2 Antibody - C-terminal region : FITC
Artikelnummer
AVIARP55542_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human TCP11L2

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: EILLSFLTPGGNRLRNQICEVLDTDLIRQQAEHSAVDIQGLANYVISTMG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: T-complex protein 11-like protein 2

Protein Size: 272

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55542_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55542_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 255394
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×