TCP11L2 Antibody - N-terminal region : Biotin

TCP11L2 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP55541_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The specific function of TCP11L2 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TCP11L2

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: VHQAFWDVLDSELNADPPEFEHAIKLFEEIREILLSFLTPGGNRLRNQIC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: T-complex protein 11-like protein 2

Protein Size: 519

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55541_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55541_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 255394
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×