TDP1 Antibody - C-terminal region : Biotin

TDP1 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP57200_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is involved in repairing stalled topoisomerase I-DNA complexes by catalyzing the hydrolysis of the phosphodiester bond between the tyrosine residue of topoisomerase I and the 3-prime phosphate of DNA. This protein may also remove glycolate from single-stranded DNA containing 3-prime phosphoglycolate, suggesting a role in repair of free-radical mediated DNA double-strand breaks. This gene is a member of the phospholipase D family and contains two PLD phosphodiesterase domains. Mutations in this gene are associated with the disease spinocerebellar ataxia with axonal neuropathy (SCAN1). While several transcript variants may exist for this gene, the full-length natures of only two have been described to date. These two represent the major variants of this gene and encode the same isoform.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of mouse TDP1

Molecular Weight: 66kDa

Peptide Sequence: Synthetic peptide located within the following region: GRPPGKSAVPLHLIYPSVENVRTSLEGYPAGGSLPYSIQTAEKQRWLHSY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: tyrosyl-DNA phosphodiesterase 1

Protein Size: 609

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57200_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57200_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55775
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×