Tdrd7 Antibody - C-terminal region : HRP

Tdrd7 Antibody - C-terminal region : HRP
Artikelnummer
AVIARP55002_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Tdrd7 binds to PCTAIRE 2, a Cdc2-related kinase expressed in the terminally differentiated neuron; contains five tudor-like domains; may mediate the regulation of mitochondrial function in the neurons.

Molecular Weight: 122kDa

Peptide Sequence: Synthetic peptide located within the following region: CSDCSIKVTKVDEARGVAYVYLFTPKNFPDPHRSINRQITNADLWKHQKD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tudor domain-containing protein 7

Protein Size: 1113

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55002_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55002_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 85425
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×