TEAD4 Recombinant Protein

TEAD4 Recombinant Protein
Artikelnummer
AVIOPCA335976-20
Verpackungseinheit
20µg
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Description of Target: Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Acts by mediating gene expression of YAP1 and WWTR1/TAZ, thereby regulating cell proliferation, migration and epithelial mesenchymal transition (EMT) induction. Binds specifically and non-cooperatively to the Sph and GT-IIC 'enhansons' (5'-GTGGAATGT-3') and activates transcription. Binds to the M-CAT motif.

Key Reference: A novel family of developmentally regulated mammalian transcription factors containing the TEA/ATTS DNA binding domain. Jacquemin P., Hwang J.-J., Martial J.A., Dolle P., Davidson I. J. Biol. Chem. 271:21775-21785(1996).

Molecular Weight: 67.3 kDa.

Product Format: Liquid or Lyophilized powder.

Protein Name: transcriptional enhancer factor TEF-3.

Protein Sequence: MYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE.

Protein Size: 74-434 aa.

Purification: Affinity purified using AC.

Purity: Greater than 85% as determined by SDS-PAGE.

Source: E. Coli.

Tag: N-terminal GST-tagged
Mehr Informationen
Artikelnummer AVIOPCA335976-20
Hersteller Aviva Systems Biology
Hersteller Artikelnummer OPCA335976-20
Green Labware Nein
Verpackungseinheit 20µg
Mengeneinheit STK
Reaktivität Human
Human Gene ID 7004
Produktinformation (PDF)
×
MSDS (PDF)
×