TEDC1 Antibody - N-terminal region : FITC

TEDC1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55661_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of human C14orf80

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: MLAQARVPLGDEMTVCQIHLYTRGCHSDQSLSHLSVTEAEMLRDPEGGQQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: tubulin epsilon and delta complex protein 1

Protein Size: 248

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55661_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55661_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 283643
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×