Tekt3 Antibody - N-terminal region : Biotin

Tekt3 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57677_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Tekt3 is a structural component of ciliary and flagellar microtubules. It forms filamentous polymers in the walls of ciliary and flagellar microtubules. It is required for progressive sperm mobility.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: MLPFVSNRTTLFTRYTPDDWYRSTLVGFQESNCSRHNSERLRVDTSRLIQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tektin-3

Protein Size: 490

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57677_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57677_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 287392
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×