TENT5C Antibody - middle region : Biotin

TENT5C Antibody - middle region : Biotin
Artikelnummer
AVIARP53723_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM46C

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: LIATKNPEEIRGGGLLKYSNLLVRDFRPTDQEEIKTLERYMCSRFFIDFP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: terminal nucleotidyltransferase 5C

Protein Size: 391

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53723_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53723_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54855
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×