TERF2IP Antibody - middle region : FITC

TERF2IP Antibody - middle region : FITC
Artikelnummer
AVIARP57302_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The gene encodes a protein that is part of a complex involved in telomere length regulation. Pseudogenes are present on chromosomes 5 and 22.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TERF2IP

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: EDPEAADSGEPQNKRTPDLPEEEYVKEEIQENEEAVKKMLVEATREFEEV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Telomeric repeat-binding factor 2-interacting protein 1

Protein Size: 399

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57302_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57302_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54386
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×