TESMIN Antibody - N-terminal region : HRP

TESMIN Antibody - N-terminal region : HRP
Artikelnummer
AVIARP53623_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Metallothionein proteins are highly conserved low-molecular-weight cysteine-rich proteins that are induced by and bind to heavy metal ions and have no enzymatic activity. They may play a central role in the regulation of cell growth and differentiation and are involved in spermatogenesis. This gene encodes a metallothionein-like protein which has been shown to be expressed differentially in mouse testis and ovary. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MTL5

Key Reference: Oh,J.H., (2005) Mamm. Genome 16 (12), 942-954

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: EAYLGPADPKEPVLHAFNPALGADCKGQVKAKLAGGDSDGGELLGEYPGI

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: tesmin

Protein Size: 508

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53623_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53623_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Dog (Canine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 9633
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×