TEX14 Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: TEX14 belongs to the protein kinase superfamily. It contains 3 ANK repeats and 1 protein kinase domain. TEX14 is required for spermatogenesis and male fertility. It may be required for normal structure of the intercellular bridge that connects spermatocytes and spermatogonia. It has no protein kinase activity.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TEX14

Molecular Weight: 164kDa

Peptide Sequence: Synthetic peptide located within the following region: TPDGEYFYSSTAQENLALETSSPIEEDFEGIQGAFAQPQVSGEEKFQMRK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Inactive serine/threonine-protein kinase TEX14

Protein Size: 1491

Purification: Affinity Purified

• Artikelnummer: AVIARP53843_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53843_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 56155
• Wirt: Rabbit
• Konjugat: Conjugated, HRP