TEX9 Antibody - middle region : FITC

TEX9 Antibody - middle region : FITC
Artikelnummer
AVIARP55895_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TEX9

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: VSNDIGTEAQIRFLKAKLHVMQEELDNVVCECNKKEDEIQNLKSQVKNFE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: testis-expressed sequence 9 protein

Protein Size: 316

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55895_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55895_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 374618
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×