Uniprot: P19532
Gene Name: TFE3
Immunogen: Recombinant human TFE3
Purity: ≥85%
Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide
Identity-Mouse (%): 92%
Core Sequence: SRQRSLEQANRSLQLRIQELELQAQIHGLPVPPTPGLLSLATTSASDSLKPEQLDIEEEGRPGAATFHVGGGPAQNAPHQQPPAPPSDALLDLHFPSDHLGDLGDPFHLGLEDILMEEEEGVVGGLSGGA
Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 92%, Rat - 63%, Pig - 96%, Cynomolgus monkey - 100%
Alternative gene names: BHLHE33
Alternative protein names: Transcription factor E3; Class E basic helix-loop-helix protein 33; bHLHe33
Protein name: Transcription factor binding to IGHM enhancer 3
Product panel: IHC Pathology
Clone No.: KAA382_17E2
Antigen Species: Human
Target Name: TFE3
IHC Verification: succeed
IHC Dilution: 1:100
WB Verification: Fail (HT-29,HeLa,Jurkat,NIH/3T3)
WB Dilution: N/A
IP Verification: -
IP Dilution: N/A
IF Verification: -
IF Dilution: N/A
Sandwich ELISA Verification: -
Sandwich ELISA Dilution: N/A
Antigen ID: P61542PCGN
Cross reactivity: Not tested
Deutsch
English
