TFEB Antibody - middle region : HRP

TFEB Antibody - middle region : HRP
Artikelnummer
AVIARP58116_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The TFEB gene fuses with an intronless gene in renal tumors harboring the t(6;11)(p21;q13) chromosome translocation. It encodes a protein that is a highly sensitive and specific diagnostic marker for renal neoplasms.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TFEB

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: DFSHSLSFGGREDEGPPGYPEPLAPGHGSPFPSLSKKDLDLMLLDDSLLP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transcription factor EB

Protein Size: 476

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58116_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58116_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rabbit, Dog (Canine), Cow (Bovine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 7942
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×