TFPI2 Antibody - middle region : FITC

TFPI2 Antibody - middle region : FITC
Artikelnummer
AVIARP58242_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TFPI2 may play a role in the regulation of plasmin-mediated matrix remodeling. It inhibits trypsin, plasmin, factor VIIa/tissue factor and weakly factor Xa. TFPI2 has no effect on thrombin.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TFPI2

Key Reference: Becker,J., (2008) Int. J. Oncol. 32 (1), 235-240

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: NANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tissue factor pathway inhibitor 2

Protein Size: 235

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58242_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58242_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 7980
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×