TGFA Antibody

Uniprot: P01135

Gene Name: TGFA

Immunogen: Recombinant human TGFA

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 92%

Core Sequence: SADPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAV

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 92%, Rat - 92%, Pig - 96%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Protransforming growth factor alpha [Cleaved into: Transforming growth factor alpha; TGF-alpha; EGF-like TGF; ETGF; TGF type 1]

Protein name: Transforming growth factor alpha

Product panel: Cytokines

Clone No.: K94027_2E8

Antigen Species: Human

Target Name: TGFA

IHC Verification: Fail (Kidney)

IHC Dilution: N/A

WB Verification: Fail (Purification of Antigens)

WB Dilution: N/A

IP Verification: -

IP Dilution: N/A

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: succeed

Sandwich ELISA Dilution: 1:250~1:500

Antigen ID: PP-3331

Cross reactivity: Not tested

• Artikelnummer: ASBKC-3012-100
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: KC-3012-100
• Verpackungseinheit: 100 μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Monoclonal
• Methode: ELISA
• Isotyp: IgG2a
• Human Gene ID: 7039
• Wirt: Mouse
• Konjugat: Unconjugated