THAP12 Antibody - N-terminal region : Biotin

THAP12 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP56594_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRKRIR

Key Reference: Lee,J.H., (2003) Korean J Gastroenterol 42 (6), 484-495

Molecular Weight: 88kDa

Peptide Sequence: Synthetic peptide located within the following region: VENCRRADLEDKTPDQLNKHYRLCAKHFETSMICRTSPYRTVLRDNAIPT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 52 kDa repressor of the inhibitor of the protein kinase

Protein Size: 761

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56594_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56594_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5612
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×