THAP12 Antibody - N-terminal region : HRP

THAP12 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56594_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRKRIR

Key Reference: Lee,J.H., (2003) Korean J Gastroenterol 42 (6), 484-495

Molecular Weight: 88kDa

Peptide Sequence: Synthetic peptide located within the following region: VENCRRADLEDKTPDQLNKHYRLCAKHFETSMICRTSPYRTVLRDNAIPT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: 52 kDa repressor of the inhibitor of the protein kinase

Protein Size: 761

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56594_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56594_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 5612
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×