THAP5 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: THAP5 contains 1 THAP-type zinc finger. The exact function of THAP5 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human THAP5

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: TTITLTTSNSESIHQSLETQEVLEVTTSHLANPNFTSNSMEIKSAQENPF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: THAP domain-containing protein 5

Protein Size: 395

Purification: Affinity Purified

• Artikelnummer: AVIARP53431_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53431_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Pig (Porcine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 168451
• Wirt: Rabbit
• Konjugat: Conjugated, FITC