THEG Antibody - middle region : Biotin

THEG Antibody - middle region : Biotin
Artikelnummer
AVIARP57809_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene is specifically expressed in the nucleus of haploid male germ cells. It encodes a protein that may be involved in the regulation of germ cell nuclear functions. Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human THEG

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: LKDRPSVYWTERFLEDTTLTITVPAVSRRVEELSRPKRFYLEYYNNNRTT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Testicular haploid expressed gene protein

Protein Size: 355

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57809_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57809_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51298
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×