THEG Antibody - middle region : HRP

THEG Antibody - middle region : HRP
Artikelnummer
AVIARP57810_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene is specifically expressed in the nucleus of haploid male germ cells. It encodes a protein that may be involved in the regulation of germ cell nuclear functions. Alternatively spliced transcript variants encoding distinct isoforms have been reported.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human THEG

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: DRPSVYWTERFLEDTTLTITVPAVSRRVEELSRPKRFYLEYYNNNRTTPV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Testicular haploid expressed gene protein

Protein Size: 355

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57810_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57810_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51298
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×