THYN1 Antibody - N-terminal region : FITC

THYN1 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP54987_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: THYN1 is a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human THYN1

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Thymocyte nuclear protein 1

Protein Size: 225

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54987_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54987_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Guinea Pig
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 29087
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×