TINAG Antibody - middle region : FITC

TINAG Antibody - middle region : FITC
Artikelnummer
AVIARP55063_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TINAG is a basement membrane glycoprotein initially identified as a target of antibodies in some forms of immunologically mediated tubulointerstitial nephritis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TINAG

Molecular Weight: 54

Peptide Sequence: Synthetic peptide located within the following region: VAADRIAIQSKGRYTANLSPQNLISCCAKNRHGCNSGSIDRAWWYLRKRG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tubulointerstitial nephritis antigen

Protein Size: 476

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55063_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55063_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 27283
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×