Tinag Antibody - middle region : FITC

Tinag Antibody - middle region : FITC
Artikelnummer
AVIARP55064_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Tinag

Molecular Weight: 52kDa

Peptide Sequence: Synthetic peptide located within the following region: SPPYRISSNETEIMREIIQNGPVQAIMQVHEDFFYYKTGIYRHVVSTNEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Tinag Ensembl ENSRNOP00000039634

Protein Size: 475

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55064_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55064_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 300846
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×