TINAG Antibody - middle region : HRP

TINAG Antibody - middle region : HRP
Artikelnummer
AVIARP55063_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TINAG is a basement membrane glycoprotein initially identified as a target of antibodies in some forms of immunologically mediated tubulointerstitial nephritis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TINAG

Molecular Weight: 54

Peptide Sequence: Synthetic peptide located within the following region: VAADRIAIQSKGRYTANLSPQNLISCCAKNRHGCNSGSIDRAWWYLRKRG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Tubulointerstitial nephritis antigen

Protein Size: 476

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55063_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55063_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 27283
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×