TINF2 Antibody - middle region : Biotin

TINF2 Antibody - middle region : Biotin
Artikelnummer
AVIARP58338_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: TINF2 is a component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends; without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways. It plays a role in shelterin complex assembly.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TINF2

Key Reference: Kim,S.H., (2008) J. Cell Biol. 181 (3), 447-460

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: SDEEENGQGEGKESLENYQKTKFDTLIPTLCEYLPPSGHGAIPVSSCDCR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: TERF1-interacting nuclear factor 2

Protein Size: 451

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58338_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58338_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 26277
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×