TKFC Antibody - N-terminal region : FITC

TKFC Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55278_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene is a member of the family of dihydroxyacetone kinases, which have a protein structure distinct from other kinases. The product of this gene phosphorylates dihydroxyacetone, and also catalyzes the formation of riboflavin 4',5'-phosphate (aka cyclin FMN) from FAD. Several alternatively spliced transcript variants have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DAK

Key Reference: Diao,F., (2007) Proc. Natl. Acad. Sci. U.S.A. 104 (28), 11706-11711

Molecular Weight: 59kDa

Peptide Sequence: Synthetic peptide located within the following region: MTSKKLVNSVAGCADDALAGLVACNPNLQLLQGHRVALRSDLDSLKGRVA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: triokinase/FMN cyclase

Protein Size: 575

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55278_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55278_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 26007
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×