TKTL1 Antibody - middle region : Biotin

TKTL1 Antibody - middle region : Biotin
Artikelnummer
AVIARP53676_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Strong TKTL1 protein expression has been correlated with a certain type of glucose metabolism (aerobic glycolysis; Warburg effect) and to cells which are affected by chronic complications of diabetic patients. In colon and urothelial carcinomas, expression at the protein level is correlated with invasiveness of tumors and poor patient survival.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TKTL1

Key Reference: Langbein,S., (2008) Int. J. Cancer 122 (11), 2422-2428

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: QIQTSRNLDPQPPIEDSPEVNITDVRMTSPPDYRVGDKIATRKACGLALA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transketolase-like protein 1

Protein Size: 596

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53676_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53676_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 8277
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×