TMED8 Antibody - middle region : Biotin

TMED8 Antibody - middle region : Biotin
Artikelnummer
AVIARP56017_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The specific function of the protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TMED8

Key Reference: Petroziello,J., (2004) Oncogene 23 (46), 7734-7745

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: EVMPVYRRDSHRDVQAGSHDYPGEGIYLLKFDNSYSLLRNKTLYFHIYYT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein TMED8

Protein Size: 325

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56017_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56017_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 283578
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×