TMEM184A Antibody - C-terminal region : Biotin

TMEM184A Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP54530_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: TMEM184A is a multi-pass membrane proteinPotential. It belongs to the UPF0206 family. The exact function of TMEM184A remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human TMEM184A

Key Reference: Scherer,S.W., (2003) Science 300 (5620), 767-772

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: CQVYAEKKENSPAPPAPMQSISSGIRETVSPQDIVQDAIHNFSPAYQHYT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transmembrane protein 184A

Protein Size: 413

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54530_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54530_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 202915
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×