TMF1 Antibody - N-terminal region : HRP

TMF1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP58092_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TMF1 binds the HIV-1 TATA element and inhibits transcriptional activation by the TATA-binding protein (TBP).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TMF1

Key Reference: Yamane,J., (2007) Exp. Cell Res. 313 (16), 3472-3485

Molecular Weight: 123kDa

Peptide Sequence: Synthetic peptide located within the following region: TPETTESQVKDSSLCVSGETLAAGTSSPKTEGKHEETVNKESDMKVPTVS

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: TATA element modulatory factor

Protein Size: 1093

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58092_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58092_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 7110
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×