Tmlhe Antibody - C-terminal region : HRP

Tmlhe Antibody - C-terminal region : HRP
Artikelnummer
AVIARP57146_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Tmlhe is a first enzyme in the carnitine biosynthesis pathway and plays an important role in the transport of fatty acids across the inner mitochondrial membrane.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Tmlhe

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: ELWVKLKPGKVLFIDNWRVLHGRESFTGYRQLCGCYLTRDDVLNTARILG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Trimethyllysine dioxygenase, mitochondrial

Protein Size: 433

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57146_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57146_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 170898
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×