TMLHE Antibody - middle region : HRP

TMLHE Antibody - middle region : HRP
Artikelnummer
AVIARP57145_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes the protein trimethyllysine dioxygenase which is the first enzyme in the carnitine biosynthesis pathway. Carnitine play an essential role in the transport of activated fatty acids across the inner mitochondrial membrane. The encoded prot

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TMLHE

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: PWNKELYLIRYNNYDRAVINTVPYDVVHRWYTAHRTLTIELRRPENEFWV

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Trimethyllysine dioxygenase, mitochondrial

Protein Size: 421

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57145_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57145_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55217
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×