TMOD3 Antibody - middle region : FITC

TMOD3 Antibody - middle region : FITC
Artikelnummer
AVIARP55078_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: TMOD3 belongs to the tropomodulin family. It blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton. This gene is a necessary element in receptor tyrosine kinase pathways, possibly as a tyrosine phosphorylation target. It is involved in regulation of RAF in the MAPK pathway and may also play a role in a MAPK-independent pathway.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TMOD3

Key Reference: Weber,K.L., J. Cell. Sci. 120 (PT 20), 3625-3632 (2007)

Molecular Weight: 39kDa

Peptide Sequence: Synthetic peptide located within the following region: ITNTKFCNIMGSSNGVDQEHFSNVVKGEKILPVFDEPPNPTNVEESLKRT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tropomodulin-3

Protein Size: 352

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55078_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55078_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 29766
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×