TNKS1BP1 Antibody - middle region : Biotin

TNKS1BP1 Antibody - middle region : Biotin
Artikelnummer
AVIARP58347_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: TNKS-1 mRNA in urine sediment from patients with bladder TCC correlated with tumor stage, and higher preoperative levels were associated with increased risk of early recurrence. Tankyrase-1 is required in the assembly of bipolar spindles and the spindle-pole protein NuMA as a substrate for covalent modification by tankyrase-1. Data also show that tankyrase 1 inhibition in human cancer cells enhances telomere shortening by a telomerase inhibitor and hastens cell death.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TNKS1BP1

Key Reference: Gelmini,S., (2007) Clin. Chem. Lab. Med. 45 (7), 862-866

Molecular Weight: 190kDa

Peptide Sequence: Synthetic peptide located within the following region: DGEASQTEDVDGTWGSSAARWSDQGPAQTSRRPSQGPPARSPSQDFSFIE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: 182 kDa tankyrase-1-binding protein

Protein Size: 1729

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58347_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58347_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 85456
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×