TNP1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: TNP1 is a spermatid-specific product of the haploid genome which replaces histone and is itself replaced in the mature sperm by the protamines.Transition protein-1 is a spermatid-specific product of the haploid genome which replaces histone and is itself replaced in the mature sperm by the protamines (see PRM1, MIM 182880; PRM2, MIM 182890) (Luerssen et al., 1990 [PubMed 2249851]).[supplied by OMIM]. Sequence Note: removed 4 bases from the 5' end that did not align to the reference genome assembly. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TNP1

Key Reference: Jedrzejczak,P., (2007) Arch. Androl. 53 (4), 199-205

Molecular Weight: 6kDa

Peptide Sequence: Synthetic peptide located within the following region: MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Spermatid nuclear transition protein 1

Protein Size: 55

Purification: Affinity Purified

• Artikelnummer: AVIARP53607_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP53607_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 7141
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin