TNP1 Antibody - N-terminal region : HRP

TNP1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP53607_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TNP1 is a spermatid-specific product of the haploid genome which replaces histone and is itself replaced in the mature sperm by the protamines.Transition protein-1 is a spermatid-specific product of the haploid genome which replaces histone and is itself replaced in the mature sperm by the protamines (see PRM1, MIM 182880; PRM2, MIM 182890) (Luerssen et al., 1990 [PubMed 2249851]).[supplied by OMIM]. Sequence Note: removed 4 bases from the 5' end that did not align to the reference genome assembly. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TNP1

Key Reference: Jedrzejczak,P., (2007) Arch. Androl. 53 (4), 199-205

Molecular Weight: 6kDa

Peptide Sequence: Synthetic peptide located within the following region: MSTSRKLKSHGMRRSKSRSPHKGVKRGGSKRKYRKGNLKSRKRGDDANRN

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Spermatid nuclear transition protein 1

Protein Size: 55

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP53607_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP53607_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 7141
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×