TOB2 Antibody - middle region : Biotin

TOB2 Antibody - middle region : Biotin
Artikelnummer
AVIARP58112_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: TOB2 belongs to the TOB/BTG1 family of antiproliferative proteins, which are involved in the regulation of cell cycle progression.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human TOB2

Molecular Weight: 37kDa

Peptide Sequence: Synthetic peptide located within the following region: EGHWYPEKPLKGSGFRCVHIGEMVDPVVELAAKRSGLAVEDVRANVPEEL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Tob2

Protein Size: 344

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58112_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58112_P050-Biotin
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 10766
Wirt Rabbit
Konjugat Conjugated, Biotin
Produktinformation (PDF) Download
MSDS (PDF)
×