TRAF3 Antibody

Uniprot: Q13114

Gene Name: TRAF3

Immunogen: Recombinant human TRAF3

Purity: ≥85%

Formulation: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.09% sodium azide

Identity-Mouse (%): 99%

Core Sequence: HEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLA

Homologies: Highest antigen sequence identity to the following orthologs: Mouse - 99%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: CAP-1；CRAF1；TRAFAMN

Alternative protein names: TNF receptor-associated factor 3; CD40 receptor-associated factor 1; CRAF1; CD40-binding protein; CD40BP; LMP1-associated protein 1; LAP1; RING-type E3 ubiquitin transferase TRAF3

Protein name: TNF receptor associated factor 3

Product panel: E3 Ligase

Clone No.: K8U006_19E6

Antigen Species: Human

Target Name: TRAF3

IHC Verification: succeed

IHC Dilution: 1:200

WB Verification: -

WB Dilution: N/A

IP Verification: succeed

IP Dilution: 1:100

IF Verification: -

IF Dilution: N/A

Sandwich ELISA Verification: -

Sandwich ELISA Dilution: N/A

Antigen ID: PP-602

Cross reactivity: Not tested

• Artikelnummer: ASBKC-2378-50
• Hersteller: Absea Biotechnology
• Hersteller Artikelnummer: KC-2378-50
• Verpackungseinheit: 50 μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine)
• Klonalität: Monoclonal
• Methode: Immunoprecipitation, Immunohistochemistry, Immunocytochemistry
• Isotyp: IgG1
• Human Gene ID: 7187
• Wirt: Mouse
• Konjugat: Unconjugated