Transcobalamin 2 antibody

Calculated MW: 48

Form: Liquid

Buffer (with preservative): PBS, 2% Sucrose, 0.09% Sodium Azide.

Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)

Uniprot ID: O88968

Antigen Species: Mouse

Immunogen: A synthetic peptide corresponding to a region of Mouse: PWMDRLSSEQLNPSVFVGLRLSSMQAGTKEDLYLHSLKIHYQQCLLRSTS

Purification: Purified by affinity chromatography

Conjugation: Unconjugated

Full Name: transcobalamin 2

• Artikelnummer: GTX04825-100
• Hersteller: GeneTex
• Hersteller Artikelnummer: GTX04825-100
• Verpackungseinheit: 100 μl
• Mengeneinheit: STK
• Reaktivität: Mouse (Murine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Isotyp: IgG
• Human Gene ID: 21452
• Wirt: Rabbit
• Konjugat: Unconjugated