TRAPPC2L Antibody - N-terminal region : HRP

TRAPPC2L Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56852_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: TRAPPC2L may play a role in vesicular transport from endoplasmic reticulum to Golgi.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TRAPPC2L

Key Reference: Rual,J.F., (2005) Nature 437 (7062), 1173-1178

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: MAVCIAVIAKENYPLYIRSTPTENELKFHYMVHTSLDVVDEKISAMGKAL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Trafficking protein particle complex subunit 2-like protein

Protein Size: 140

Purification: Affinity Purified

Subunit: 2-like protein
Mehr Informationen
Artikelnummer AVIARP56852_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56852_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51693
Wirt Rabbit
Konjugat Conjugated, HRP
Produktinformation (PDF) Download
MSDS (PDF)
×